PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf01184g11003.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB_related
Protein Properties Length: 220aa    MW: 25649.7 Da    PI: 6.6003
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf01184g11003.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding605.1e-192669146
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
           Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                              r+++T+eE+e+l+ a++ +G++ W+ Iar ++ gRt++ +k++w+ 
  Niben101Scf01184g11003.1 26 RNPFTEEEEERLLSAHRIHGNR-WAIIARLFP-GRTDNAVKNHWHV 69
                              789*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.26E-22976IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.1E-9933IPR009057Homeodomain-like
PROSITE profilePS5129426.8452175IPR017930Myb domain
SMARTSM007172.8E-162573IPR001005SANT/Myb domain
PfamPF002494.2E-162668IPR001005SANT/Myb domain
CDDcd001675.42E-122868No hitNo description
Gene3DG3DSA:1.10.10.604.6E-183469IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 220 aa     Download sequence    Send to blast
MLVTIYLVGK SCRLRWFNQL DPRINRNPFT EEEEERLLSA HRIHGNRWAI IARLFPGRTD  60
NAVKNHWHVI MARKCRERSK IYSKRAAAAA ATATTAAHKK SMSNEQETSW SKQQDNYMQI  120
SNEIMITRCF NSLTYNYSFN PGLLHNDYLF HHAKMDQVLC TDENQQTEFY DFLQVNTDSN  180
KSEVMDHAAR IRDEEEVEQE AVDLPQNAQF IDFLSVGDSA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-2287541108B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009778312.11e-133PREDICTED: transcriptional activator Myb-like
RefseqXP_016501383.11e-133PREDICTED: transcriptional activator Myb-like
TrEMBLA0A061FVI94e-71A0A061FVI9_THECC; Myb domain protein 52 isoform 2 (Fragment)
STRINGVIT_17s0000g01890.t011e-69(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA17842466
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G17950.11e-55myb domain protein 52